PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi2g54670.8.p
Common NameLOC100843948
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family GRAS
Protein Properties Length: 806aa    MW: 88928.4 Da    PI: 6.1927
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi2g54670.8.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS388.76.5e-1194307992374
              GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfs 94 
                       ++lL++cA+ vs +d + a++lL++++++as +gd  qRla++f+++L+arla+++s++yk+++ s+ +    +++l+a++l+  ++P+ k+s
  Bradi2g54670.8.p 430 ETLLIHCAQSVSIDDRRSATELLKQIRQHASANGDGDQRLAHCFANGLEARLAGNGSQIYKSFTISRLA---CTDVLKAYQLYLAACPFKKIS 519
                       789****************************************************************99...9******************** PP

              GRAS  95 hltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakr 185
                       h  aNq+I++ave++++vHiiD++i +G+QWp+L+q L++R++gpp+lRiTg++ p++g   +e+++etg+ L+++A++++vpfef+  +a++
  Bradi2g54670.8.p 520 HYFANQTIMNAVEKAKKVHIIDYGIYYGFQWPCLIQRLSTRAGGPPKLRITGIDTPQPGfrPAERIQETGRYLSDYAQTFKVPFEFQG-IASQ 611
                       ****************************************************************************************.7*** PP

              GRAS 186 ledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpre 278
                       +e++++e+L+++++E+l+Vn++++ ++l+desv  es+r+ vL+++++++P+v+++   + ++n++ F+ rf eal +ysa fd+lea++pr+
  Bradi2g54670.8.p 612 FEAVQIEDLHIEKDEVLIVNCMFKFKTLMDESVVAESPRNIVLNTIRKMKPHVFIHGITNGSYNAPFFVSRFREALFHYSAAFDMLEANIPRD 704
                       ********************************************************************************************* PP

              GRAS 279 seerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvS 371
                       +e+r  +E +l++re+ nv++ceg er er et+++W+ r ++aGFk++pl+++++k a+  ++ ++++ + ++e++ +l++gWk+r L+++S
  Bradi2g54670.8.p 705 NEQRLLIESALFNREAINVISCEGLERMERPETYKQWQTRNQRAGFKQLPLNQDIMKRAREKVKCYHKN-FIIDEDNRWLLQGWKGRILFALS 796
                       ****************************************************************99966.*********************** PP

              GRAS 372 aWr 374
                        W+
  Bradi2g54670.8.p 797 TWK 799
                       **8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098567.803403780IPR005202Transcription factor GRAS
PfamPF035142.3E-116430799IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 806 aa     Download sequence    Send to blast
MVMDATLHDW SAPLPGSNSK CDGHLPIYPQ IPAANGFTVE ELEALLVLPS DGVDAEGYLN  60
AAAASTDSAS PPREVSVSSA PPPAGPGQAP PDDSEGFSDI VLGYINRMLM AEDIDEKFEH  120
YPSLLSAEKP FLDILADHPP YSGGSTVDSP DGSSVTNSCN SLGSCHCAAP SSGLGQTPPF  180
LEFPTAAFLQ PPRLYQDPSP ESCVVDAGGA WPYDPTEFYQ LHTNPVPETL LSQSSSFASS  240
NGSSVAFSEG FESWLSTAGV VPDVGLSNFV LQNQQAAQFS RGFEEASRFL PVESKLVIDV  300
ESLLSVASLQ AGVKEEKFVE VKTEKAGAEV AVHRGKKHFY GDDLDVEEGR CCKHSAPAII  360
DSDHLVREMM DKVLLCNGET CSKGVKELRE ALRHDVANHP SGAHGKGSGH GKGRGKKQSK  420
QPKKEVVDLE TLLIHCAQSV SIDDRRSATE LLKQIRQHAS ANGDGDQRLA HCFANGLEAR  480
LAGNGSQIYK SFTISRLACT DVLKAYQLYL AACPFKKISH YFANQTIMNA VEKAKKVHII  540
DYGIYYGFQW PCLIQRLSTR AGGPPKLRIT GIDTPQPGFR PAERIQETGR YLSDYAQTFK  600
VPFEFQGIAS QFEAVQIEDL HIEKDEVLIV NCMFKFKTLM DESVVAESPR NIVLNTIRKM  660
KPHVFIHGIT NGSYNAPFFV SRFREALFHY SAAFDMLEAN IPRDNEQRLL IESALFNREA  720
INVISCEGLE RMERPETYKQ WQTRNQRAGF KQLPLNQDIM KRAREKVKCY HKNFIIDEDN  780
RWLLQGWKGR ILFALSTWKP NHHSS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A7e-514337998375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003564590.10.0PREDICTED: scarecrow-like protein 9
TrEMBLI1HTA20.0I1HTA2_BRADI; Uncharacterized protein
STRINGBRADI2G54670.20.0(Brachypodium distachyon)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-172GRAS family protein